GTF2A2 MaxPab mouse polyclonal antibody (B02) View larger

GTF2A2 MaxPab mouse polyclonal antibody (B02)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GTF2A2 MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about GTF2A2 MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00002958-B02
Product name: GTF2A2 MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human GTF2A2 protein.
Gene id: 2958
Gene name: GTF2A2
Gene alias: HsT18745|TF2A2|TFIIA
Gene description: general transcription factor IIA, 2, 12kDa
Genbank accession: NM_004492.1
Immunogen: GTF2A2 (NP_004483.1, 1 a.a. ~ 109 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Protein accession: NP_004483.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002958-B02-13-15-1.jpg
Application image note: Western Blot analysis of GTF2A2 expression in transfected 293T cell line (H00002958-T02) by GTF2A2 MaxPab polyclonal antibody.

Lane 1: GTF2A2 transfected lysate(11.99 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GTF2A2 MaxPab mouse polyclonal antibody (B02) now

Add to cart