| Brand: | Abnova |
| Reference: | H00002954-M01 |
| Product name: | GSTZ1 monoclonal antibody (M01), clone 1G12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GSTZ1. |
| Clone: | 1G12 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2954 |
| Gene name: | GSTZ1 |
| Gene alias: | GSTZ1-1|MAAI|MAI|MGC2029 |
| Gene description: | glutathione transferase zeta 1 |
| Genbank accession: | NM_145870 |
| Immunogen: | GSTZ1 (NP_665877, 109 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA |
| Protein accession: | NP_665877 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to GSTZ1 on HepG2 cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |