No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Rabbit |
Applications | WB-Ce,WB-Tr |
Brand: | Abnova |
Reference: | H00002953-D01P |
Product name: | GSTT2 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human GSTT2 protein. |
Gene id: | 2953 |
Gene name: | GSTT2 |
Gene alias: | MGC182032 |
Gene description: | glutathione S-transferase theta 2 |
Genbank accession: | NM_000854.2 |
Immunogen: | GSTT2 (NP_000845.1, 1 a.a. ~ 244 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP |
Protein accession: | NP_000845.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | Western Blot analysis of GSTT2 expression in transfected 293T cell line (H00002953-T01) by GSTT2 MaxPab polyclonal antibody. Lane 1: GSTT2 transfected lysate(27.50 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Tr |
Shipping condition: | Dry Ice |