Cart 38 Product Products 11 595,70 € (empty)
No products
To be determined Shipping
11 595,70 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 38 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 11 595,70 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 11 595,70 €
Data sheet of GSTP1 monoclonal antibody (M01), clone 2G6-F6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about GSTP1 monoclonal antibody (M01), clone 2G6-F6
| Brand: | Abnova |
| Reference: | H00002950-M01 |
| Product name: | GSTP1 monoclonal antibody (M01), clone 2G6-F6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant GSTP1. |
| Clone: | 2G6-F6 |
| Isotype: | IgG1 kappa |
| Gene id: | 2950 |
| Gene name: | GSTP1 |
| Gene alias: | DFN7|FAEES3|GST3|PI |
| Gene description: | glutathione S-transferase pi 1 |
| Genbank accession: | BC010915 |
| Immunogen: | GSTP1 (AAH10915, 1 a.a. ~ 210 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPEFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
| Protein accession: | AAH10915 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (48.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to GSTP1 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Polymorphism of the glutathione S-transferase P1 gene (GST-pi) in breast carcinoma.Khabaz MN. Pol J Pathol. 2014 Jun;65(2):141-6. |