No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ce,WB-Ti,WB-Tr,PLA-Ce |
Brand: | Abnova |
Reference: | H00002950-D01P |
Product name: | GSTP1 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human GSTP1 protein. |
Gene id: | 2950 |
Gene name: | GSTP1 |
Gene alias: | DFN7|FAEES3|GST3|PI |
Gene description: | glutathione S-transferase pi 1 |
Genbank accession: | BC010915.1 |
Immunogen: | GSTP1 (AAH10915.1, 1 a.a. ~ 210 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
Protein accession: | AAH10915.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Western Blot analysis of GSTP1 expression in transfected 293T cell line (H00002950-T01) by GSTP1 MaxPab polyclonal antibody. Lane 1: GSTP1 transfected lysate(23.30 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Ti,WB-Tr,PLA-Ce |
Shipping condition: | Dry Ice |
Publications: | Phosphorylation of Glutathione S-Transferase P1 (GSTP1) by Epidermal Growth Factor Receptor (EGFR) Promotes Formation of the GSTP1-c-Jun N-terminal kinase (JNK) Complex and Suppresses JNK Downstream Signaling and Apoptosis in Brain Tumor Cells.Okamura T, Antoun G, Keir ST, Friedman H, Bigner DD, Ali-Osman F. J Biol Chem. 2015 Dec 25;290(52):30866-78. doi: 10.1074/jbc.M115.656140. Epub 2015 Oct 1. |