View larger

GSTM4 monoclonal antibody (M01), clone 4B4

Reference:

Condition: New product

Data sheet of GSTM4 monoclonal antibody (M01), clone 4B4

Brand:	Abnova
Reference:	H00002948-M01
Product name:	GSTM4 monoclonal antibody (M01), clone 4B4
Product description:	Mouse monoclonal antibody raised against a partial recombinant GSTM4.
Clone:	4B4
Isotype:	IgG2a Kappa
Gene id:	2948
Gene name:	GSTM4
Gene alias:	GSTM4-4\|GTM4\|MGC131945\|MGC9247
Gene description:	glutathione S-transferase mu 4
Genbank accession:	BC015513
Immunogen:	GSTM4 (AAH15513.1, 23 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	YTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPD
Protein accession:	AAH15513.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.41 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of GSTM4 expression in transfected 293T cell line by GSTM4 monoclonal antibody (M01), clone 4B4. Lane 1: GSTM4 transfected lysate(25.6 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition:	Dry Ice