Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GSTM2 monoclonal antibody (M03), clone 1E10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about GSTM2 monoclonal antibody (M03), clone 1E10
| Brand: | Abnova |
| Reference: | H00002946-M03 |
| Product name: | GSTM2 monoclonal antibody (M03), clone 1E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GSTM2. |
| Clone: | 1E10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2946 |
| Gene name: | GSTM2 |
| Gene alias: | GST4|GSTM|GSTM2-2|GTHMUS|MGC117303 |
| Gene description: | glutathione S-transferase mu 2 (muscle) |
| Genbank accession: | NM_000848 |
| Immunogen: | GSTM2 (NP_000839, 90 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFE |
| Protein accession: | NP_000839 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | GSTM2 monoclonal antibody (M03), clone 1E10. Western Blot analysis of GSTM2 expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A DNA hypermethylation profile reveals new potential biomarkers for prostate cancer diagnosis and prognosis.Ashour N, Angulo JC, Andres G, Alelu R, Gonzalez-Corpas A, Toledo MV, Rodriguez-Barbero JM, Lopez JI, Sanchez-Chapado M, Ropero S Prostate. 2014 Sep;74(12):1171-82. doi: 10.1002/pros.22833. Epub 2014 Jun 24. |