View larger

GSTA4 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of GSTA4 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00002941-A01
Product name:	GSTA4 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant GSTA4.
Gene id:	2941
Gene name:	GSTA4
Gene alias:	DKFZp686D21185\|GSTA4-4\|GTA4
Gene description:	glutathione S-transferase alpha 4
Genbank accession:	NM_001512
Immunogen:	GSTA4 (NP_001503, 168 a.a. ~ 222 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	EEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Protein accession:	NP_001503
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (32.16 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Carbonylation of adipose proteins in obesity and insulin resistance: Identification of adipocyte fatty acid-binding protein as a cellular target of 4-hydroxynonenal.Grimsrud PA, Picklo MJ Sr, Griffin TJ, Bernlohr DA. Mol Cell Proteomics. 2007 Apr;6(4):624-37. Epub 2007 Jan 6.