No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00002939-M05 |
| Product name: | GSTA2 monoclonal antibody (M05), clone 3D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GSTA2. |
| Clone: | 3D4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2939 |
| Gene name: | GSTA2 |
| Gene alias: | GST2|GSTA2-2|GTA2|GTH2|MGC10525 |
| Gene description: | glutathione S-transferase alpha 2 |
| Genbank accession: | BC002895 |
| Immunogen: | GSTA2 (AAH02895, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIA |
| Protein accession: | AAH02895 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | GSTA2 monoclonal antibody (M05), clone 3D4. Western Blot analysis of GSTA2 expression in HepG2(Cat # L019V1 ). |
| Applications: | WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |