No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00002922-M03 |
Product name: | GRP monoclonal antibody (M03), clone 3A11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant GRP. |
Clone: | 3A11 |
Isotype: | IgG2b Kappa |
Gene id: | 2922 |
Gene name: | GRP |
Gene alias: | BN|GRP-10|preproGRP|proGRP |
Gene description: | gastrin-releasing peptide |
Genbank accession: | BC004488 |
Immunogen: | GRP (AAH04488, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ |
Protein accession: | AAH04488 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (42.02 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of GRP expression in transfected 293T cell line by GRP monoclonal antibody (M03), clone 3A11. Lane 1: GRP transfected lysate(16.39 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |