Brand: | Abnova |
Reference: | H00002919-M01 |
Product name: | CXCL1 monoclonal antibody (M01), clone 7A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CXCL1. |
Clone: | 7A11 |
Isotype: | IgG1 Kappa |
Gene id: | 2919 |
Gene name: | CXCL1 |
Gene alias: | FSP|GRO1|GROa|MGSA|MGSA-a|NAP-3|SCYB1 |
Gene description: | chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) |
Genbank accession: | BC011976 |
Immunogen: | CXCL1 (AAH11976, 36 a.a. ~ 107 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
Protein accession: | AAH11976 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CXCL1 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Biomarkers for Inflammatory Disease and Methods of Using SameCuff M, Ruzek MC, Voss JW. United States Patent Application. 2016 Jan 7. 20160000936A1 |