Cart 8 Product Products 3 057,00 € (empty)
No products
To be determined Shipping
3 057,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 8 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 057,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 057,00 €
Data sheet of CXCL1 monoclonal antibody (M01), clone 7A11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about CXCL1 monoclonal antibody (M01), clone 7A11
| Brand: | Abnova |
| Reference: | H00002919-M01 |
| Product name: | CXCL1 monoclonal antibody (M01), clone 7A11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CXCL1. |
| Clone: | 7A11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2919 |
| Gene name: | CXCL1 |
| Gene alias: | FSP|GRO1|GROa|MGSA|MGSA-a|NAP-3|SCYB1 |
| Gene description: | chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) |
| Genbank accession: | BC011976 |
| Immunogen: | CXCL1 (AAH11976, 36 a.a. ~ 107 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
| Protein accession: | AAH11976 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CXCL1 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Biomarkers for Inflammatory Disease and Methods of Using SameCuff M, Ruzek MC, Voss JW. United States Patent Application. 2016 Jan 7. 20160000936A1 |