| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00002919-D01P |
| Product name: | CXCL1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CXCL1 protein. |
| Gene id: | 2919 |
| Gene name: | CXCL1 |
| Gene alias: | FSP|GRO1|GROa|MGSA|MGSA-a|NAP-3|SCYB1 |
| Gene description: | chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) |
| Genbank accession: | NM_001511 |
| Immunogen: | CXCL1 (NP_001502.1, 1 a.a. ~ 107 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
| Protein accession: | NP_001502.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of CXCL1 expression in transfected 293T cell line (H00002919-T01) by CXCL1 MaxPab polyclonal antibody. Lane 1: CXCL1 transfected lysate(11.30 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Biomarkers for Inflammatory Disease and Methods of Using SameCuff M, Ruzek MC, Voss JW. United States Patent Application. 2016 Jan 7. 20160000936A1 |