View larger

GRM2 monoclonal antibody (M03), clone 3H7

Reference:

Condition: New product

Data sheet of GRM2 monoclonal antibody (M03), clone 3H7

Brand:	Abnova
Reference:	H00002912-M03
Product name:	GRM2 monoclonal antibody (M03), clone 3H7
Product description:	Mouse monoclonal antibody raised against a partial recombinant GRM2.
Clone:	3H7
Isotype:	IgG2a Kappa
Gene id:	2912
Gene name:	GRM2
Gene alias:	GLUR2\|GPRC1B\|MGLUR2\|mGlu2
Gene description:	glutamate receptor, metabotropic 2
Genbank accession:	NM_000839
Immunogen:	GRM2 (NP_000830, 414 a.a. ~ 506 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	NGRRLYKDFVLNVKFDAPFRPADTHNEVRFDRFGDGIGRYNIFTYLRAGSGRYRYQKVGYWAEGLTLDTSLIPWASPSAGPLAASRCSEPCLQ
Protein accession:	NP_000830
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged GRM2 is approximately 0.3ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA
Shipping condition:	Dry Ice