GRN polyclonal antibody (A01) View larger

GRN polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRN polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about GRN polyclonal antibody (A01)

Brand: Abnova
Reference: H00002896-A01
Product name: GRN polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant GRN.
Gene id: 2896
Gene name: GRN
Gene alias: GEP|GP88|PCDGF|PEPI|PGRN
Gene description: granulin
Genbank accession: NM_002087
Immunogen: GRN (NP_002078, 494 a.a. ~ 593 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SCEKEVVSAQPATFLARSPHVAVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL
Protein accession: NP_002078
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002896-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002896-A01-1-12-1.jpg
Application image note: GRN polyclonal antibody (A01), Lot # 061206JCSa Western Blot analysis of GRN expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Progranulin promotes Temozolomide resistance of glioblastoma by orchestrating DNA repair and tumor stemness.Bandey I, Chiou SH, Huang AP, Tsai JC, Tu PH
Oncogene. 2014 May 5. doi: 10.1038/onc.2014.92.

Reviews

Buy GRN polyclonal antibody (A01) now

Add to cart