Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GRID1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about GRID1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00002894-A01 |
| Product name: | GRID1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant GRID1. |
| Gene id: | 2894 |
| Gene name: | GRID1 |
| Gene alias: | KIAA1220 |
| Gene description: | glutamate receptor, ionotropic, delta 1 |
| Genbank accession: | NM_017551 |
| Immunogen: | GRID1 (NP_060021, 349 a.a. ~ 441 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV |
| Protein accession: | NP_060021 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.34 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Orphan Glutamate Receptor delta1 Subunit Required for High-Frequency Hearing.Gao J, Maison SF, Wu X, Hirose K, Jones SM, Bayazitov I, Tian Y, Mittleman G, Matthews DB, Zakharenko SS, Liberman MC, Zuo J. Mol Cell Biol. 2007 Jun;27(12):4500-12. Epub 2007 Apr 16. |