Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GRB10 monoclonal antibody (M01), clone 1A7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about GRB10 monoclonal antibody (M01), clone 1A7
| Brand: | Abnova |
| Reference: | H00002887-M01 |
| Product name: | GRB10 monoclonal antibody (M01), clone 1A7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GRB10. |
| Clone: | 1A7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2887 |
| Gene name: | GRB10 |
| Gene alias: | GRB-IR|Grb-10|IRBP|KIAA0207|MEG1|RSS |
| Gene description: | growth factor receptor-bound protein 10 |
| Genbank accession: | BC024285 |
| Immunogen: | GRB10 (AAH24285, 61 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNS |
| Protein accession: | AAH24285 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GRB10 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |