| Brand: | Abnova |
| Reference: | H00002874-M01 |
| Product name: | GPS2 monoclonal antibody (M01), clone 3C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GPS2. |
| Clone: | 3C4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2874 |
| Gene name: | GPS2 |
| Gene alias: | AMF-1|MGC104294|MGC119287|MGC119288|MGC119289 |
| Gene description: | G protein pathway suppressor 2 |
| Genbank accession: | BC013652 |
| Immunogen: | GPS2 (AAH13652, 228 a.a. ~ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK |
| Protein accession: | AAH13652 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GPS2 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis.Sanyal S, Bavner A, Haroniti A, Nilsson LM, Lundasen T, Rehnmark S, Witt MR, Einarsson C, Talianidis I, Gustafsson JA, Treuter E. Proc Natl Acad Sci U S A. 2007 Oct 2;104(40):15665-70. Epub 2007 Sep 25. |