| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00002874-D01P |
| Product name: | GPS2 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human GPS2 protein. |
| Gene id: | 2874 |
| Gene name: | GPS2 |
| Gene alias: | AMF-1|MGC104294|MGC119287|MGC119288|MGC119289 |
| Gene description: | G protein pathway suppressor 2 |
| Genbank accession: | NM_004489 |
| Immunogen: | GPS2 (NP_004480.1, 1 a.a. ~ 327 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK |
| Protein accession: | NP_004480.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of GPS2 expression in transfected 293T cell line (H00002874-T03) by GPS2 MaxPab polyclonal antibody. Lane 1: GPS2 transfected lysate(36.70 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |