No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00002872-A02 |
Product name: | MKNK2 polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MKNK2. |
Gene id: | 2872 |
Gene name: | MKNK2 |
Gene alias: | GPRK7|MNK2 |
Gene description: | MAP kinase interacting serine/threonine kinase 2 |
Genbank accession: | BC018345 |
Immunogen: | MKNK2 (AAH18345, 41 a.a. ~ 158 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | GRCGSDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLVRDAKQRLSAAQVLQHPWVQGCAPENTLPTPMVLQRWDSHFLLPPHPCRIHVRPGGLVRTVTVNE |
Protein accession: | AAH18345 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.98 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | MKNK2 polyclonal antibody (A02), Lot # 060717JCS1 Western Blot analysis of MKNK2 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |