Cart 145 Product Products 54 023,53 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Caspase-1...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x GIPR...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
54 023,53 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 145 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 54 023,53 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 54 023,53 €
Data sheet of GRK6 monoclonal antibody (M10), clone 8D4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about GRK6 monoclonal antibody (M10), clone 8D4
| Brand: | Abnova |
| Reference: | H00002870-M10 |
| Product name: | GRK6 monoclonal antibody (M10), clone 8D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GRK6. |
| Clone: | 8D4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2870 |
| Gene name: | GRK6 |
| Gene alias: | FLJ32135|GPRK6 |
| Gene description: | G protein-coupled receptor kinase 6 |
| Genbank accession: | BC017272 |
| Immunogen: | GRK6 (AAH17272, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQNFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKDLFQELTRLTHEYLSVAPFADYLDSIYFNRF |
| Protein accession: | AAH17272 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GRK6 monoclonal antibody (M10), clone 8D4 Western Blot analysis of GRK6 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Impaired Recruitment of Grk6 and beta-Arrestin2 Causes Delayed Internalization and Desensitization of a WHIM Syndrome-Associated CXCR4 Mutant Receptor.McCormick PJ, Segarra M, Gasperini P, Gulino AV, Tosato G. PLoS One. 2009 Dec 1;4(12):e8102. |