No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00002870-M10 |
Product name: | GRK6 monoclonal antibody (M10), clone 8D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GRK6. |
Clone: | 8D4 |
Isotype: | IgG2b Kappa |
Gene id: | 2870 |
Gene name: | GRK6 |
Gene alias: | FLJ32135|GPRK6 |
Gene description: | G protein-coupled receptor kinase 6 |
Genbank accession: | BC017272 |
Immunogen: | GRK6 (AAH17272, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQNFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKDLFQELTRLTHEYLSVAPFADYLDSIYFNRF |
Protein accession: | AAH17272 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | GRK6 monoclonal antibody (M10), clone 8D4 Western Blot analysis of GRK6 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Impaired Recruitment of Grk6 and beta-Arrestin2 Causes Delayed Internalization and Desensitization of a WHIM Syndrome-Associated CXCR4 Mutant Receptor.McCormick PJ, Segarra M, Gasperini P, Gulino AV, Tosato G. PLoS One. 2009 Dec 1;4(12):e8102. |