GRK6 monoclonal antibody (M09), clone 8D9 View larger

GRK6 monoclonal antibody (M09), clone 8D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRK6 monoclonal antibody (M09), clone 8D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about GRK6 monoclonal antibody (M09), clone 8D9

Brand: Abnova
Reference: H00002870-M09
Product name: GRK6 monoclonal antibody (M09), clone 8D9
Product description: Mouse monoclonal antibody raised against a partial recombinant GRK6.
Clone: 8D9
Isotype: IgG1 Kappa
Gene id: 2870
Gene name: GRK6
Gene alias: FLJ32135|GPRK6
Gene description: G protein-coupled receptor kinase 6
Genbank accession: BC017272
Immunogen: GRK6 (AAH17272, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQNFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKDLFQELTRLTHEYLSVAPFADYLDSIYFNRF
Protein accession: AAH17272
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002870-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00002870-M09-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GRK6 is approximately 0.3ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GRK6 monoclonal antibody (M09), clone 8D9 now

Add to cart