| Brand: | Abnova |
| Reference: | H00002870-M06 |
| Product name: | GRK6 monoclonal antibody (M06), clone 2G1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GRK6. |
| Clone: | 2G1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2870 |
| Gene name: | GRK6 |
| Gene alias: | FLJ32135|GPRK6 |
| Gene description: | G protein-coupled receptor kinase 6 |
| Genbank accession: | BC017272 |
| Immunogen: | GRK6 (AAH17272, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQNFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKDLFQELTRLTHEYLSVAPFADYLDSIYFNRF |
| Protein accession: | AAH17272 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | GRK6 monoclonal antibody (M06), clone 2G1 Western Blot analysis of GRK6 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |