GRK4 monoclonal antibody (M02), clone 6D5 View larger

GRK4 monoclonal antibody (M02), clone 6D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRK4 monoclonal antibody (M02), clone 6D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GRK4 monoclonal antibody (M02), clone 6D5

Brand: Abnova
Reference: H00002868-M02
Product name: GRK4 monoclonal antibody (M02), clone 6D5
Product description: Mouse monoclonal antibody raised against a partial recombinant GRK4.
Clone: 6D5
Isotype: IgG2b Kappa
Gene id: 2868
Gene name: GRK4
Gene alias: GPRK2L|GPRK4|GRK4a|IT11
Gene description: G protein-coupled receptor kinase 4
Genbank accession: NM_182982
Immunogen: GRK4 (NP_892027, 36 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDTKPTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFNDKLAAPLPEIPPDVVTECRLGLKEENPSKKAFEE
Protein accession: NP_892027
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002868-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002868-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged GRK4 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GRK4 monoclonal antibody (M02), clone 6D5 now

Add to cart