GRK4 monoclonal antibody (M01A), clone 6D12 View larger

GRK4 monoclonal antibody (M01A), clone 6D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRK4 monoclonal antibody (M01A), clone 6D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about GRK4 monoclonal antibody (M01A), clone 6D12

Brand: Abnova
Reference: H00002868-M01A
Product name: GRK4 monoclonal antibody (M01A), clone 6D12
Product description: Mouse monoclonal antibody raised against a partial recombinant GRK4.
Clone: 6D12
Isotype: IgG2b Kappa
Gene id: 2868
Gene name: GRK4
Gene alias: GPRK2L|GPRK4|GRK4a|IT11
Gene description: G protein-coupled receptor kinase 4
Genbank accession: NM_182982
Immunogen: GRK4 (NP_892027, 36 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDTKPTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFNDKLAAPLPEIPPDVVTECRLGLKEENPSKKAFEE
Protein accession: NP_892027
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002868-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GRK4 monoclonal antibody (M01A), clone 6D12 now

Add to cart