Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FFAR2 monoclonal antibody (M02), clone 3B3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA |
More info about FFAR2 monoclonal antibody (M02), clone 3B3
| Brand: | Abnova |
| Reference: | H00002867-M02 |
| Product name: | FFAR2 monoclonal antibody (M02), clone 3B3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FFAR2. |
| Clone: | 3B3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2867 |
| Gene name: | FFAR2 |
| Gene alias: | FFA2R|GPR43 |
| Gene description: | free fatty acid receptor 2 |
| Genbank accession: | NM_005306.1 |
| Immunogen: | FFAR2 (NP_005297.1, 231 a.a. ~ 330 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE |
| Protein accession: | NP_005297.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FFAR2 monoclonal antibody (M02), clone 3B3. Western Blot analysis of FFAR2 expression in HeLa. |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |