Brand: | Abnova |
Reference: | H00002867-M02 |
Product name: | FFAR2 monoclonal antibody (M02), clone 3B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FFAR2. |
Clone: | 3B3 |
Isotype: | IgG2a Kappa |
Gene id: | 2867 |
Gene name: | FFAR2 |
Gene alias: | FFA2R|GPR43 |
Gene description: | free fatty acid receptor 2 |
Genbank accession: | NM_005306.1 |
Immunogen: | FFAR2 (NP_005297.1, 231 a.a. ~ 330 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE |
Protein accession: | NP_005297.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FFAR2 monoclonal antibody (M02), clone 3B3. Western Blot analysis of FFAR2 expression in HeLa. |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |