Brand: | Abnova |
Reference: | H00002827-M01 |
Product name: | GPR3 monoclonal antibody (M01), clone 3B4-G3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant GPR3. |
Clone: | 3B4-G3 |
Isotype: | IgG2a kappa |
Gene id: | 2827 |
Gene name: | GPR3 |
Gene alias: | ACCA |
Gene description: | G protein-coupled receptor 3 |
Genbank accession: | BC032702 |
Immunogen: | GPR3 (AAH32702, 1 a.a. ~ 330 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV |
Protein accession: | AAH32702 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (62.04 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to GPR3 on formalin-fixed paraffin-embedded human transitional cell carcinoma tissue. [antibody concentration 1 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |