| Brand: | Abnova |
| Reference: | H00002817-A01 |
| Product name: | GPC1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant GPC1. |
| Gene id: | 2817 |
| Gene name: | GPC1 |
| Gene alias: | FLJ38078|glypican |
| Gene description: | glypican 1 |
| Genbank accession: | NM_002081 |
| Immunogen: | GPC1 (NP_002072, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | DPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFG |
| Protein accession: | NP_002072 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Internalization and Trafficking of Cell Surface Proteoglycans and Proteoglycan-Binding Ligands.Payne CK, Jones SA, Chen C, Zhuang X. Traffic. 2007 Apr;8(4):389-401. |