| Brand: | Abnova |
| Reference: | H00002810-M02 |
| Product name: | SFN monoclonal antibody (M02), clone 2G2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SFN. |
| Clone: | 2G2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2810 |
| Gene name: | SFN |
| Gene alias: | YWHAS |
| Gene description: | stratifin |
| Genbank accession: | BC000329 |
| Immunogen: | SFN (AAH00329.1, 1 a.a. ~ 248 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKAETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS |
| Protein accession: | AAH00329.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (53.02 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SFN monoclonal antibody (M02), clone 2G2. Western Blot analysis of SFN expression in U-2 OS ( Cat # L022V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |