Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SFN monoclonal antibody (M01), clone 3C3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,ELISA,WB-Re,WB-Tr,IP |
More info about SFN monoclonal antibody (M01), clone 3C3
| Brand: | Abnova |
| Reference: | H00002810-M01 |
| Product name: | SFN monoclonal antibody (M01), clone 3C3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SFN. |
| Clone: | 3C3 |
| Isotype: | IgG1 kappa |
| Gene id: | 2810 |
| Gene name: | SFN |
| Gene alias: | YWHAS |
| Gene description: | stratifin |
| Genbank accession: | BC000329 |
| Immunogen: | SFN (AAH00329.1, 1 a.a. ~ 248 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKAETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS |
| Protein accession: | AAH00329.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (53.02 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SFN on formalin-fixed paraffin-embedded human uterine cervix tissue. [antibody concentration 5 ug/ml] |
| Applications: | WB-Ce,IHC-P,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | An inverse switch in DNA base excision and strand break repair contributes to melphalan resistance in multiple myeloma cells.Sousa MM, Zub KA, Aas PA, Hanssen-Bauer A, Demirovic A, Sarno A, Tian E, Liabakk NB, Slupphaug G PLoS One. 2013;8(2):e55493. doi: 10.1371/journal.pone.0055493. Epub 2013 Feb 6. |