| Brand: | Abnova |
| Reference: | H00002810-D01P |
| Product name: | SFN purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human SFN protein. |
| Gene id: | 2810 |
| Gene name: | SFN |
| Gene alias: | YWHAS |
| Gene description: | stratifin |
| Genbank accession: | NM_006142 |
| Immunogen: | SFN (NP_006133.1, 1 a.a. ~ 248 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS |
| Protein accession: | NP_006133.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SFN MaxPab rabbit polyclonal antibody. Western Blot analysis of SFN expression in human colon. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |