Cart 32 Product Products 10 313,57 € (empty)
No products
To be determined Shipping
10 313,57 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 32 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 10 313,57 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 10 313,57 €
Data sheet of GOT2 monoclonal antibody (M09), clone 4H8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about GOT2 monoclonal antibody (M09), clone 4H8
| Brand: | Abnova |
| Reference: | H00002806-M09 |
| Product name: | GOT2 monoclonal antibody (M09), clone 4H8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GOT2. |
| Clone: | 4H8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2806 |
| Gene name: | GOT2 |
| Gene alias: | FLJ40994|KAT4|KATIV|mitAAT |
| Gene description: | glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2) |
| Genbank accession: | NM_002080 |
| Immunogen: | GOT2 (NP_002071, 331 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK |
| Protein accession: | NP_002071 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GOT2 monoclonal antibody (M09), clone 4H8. Western Blot analysis of GOT2 expression in HepG2(Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |