| Brand: | Abnova |
| Reference: | H00002806-A01 |
| Product name: | GOT2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant GOT2. |
| Gene id: | 2806 |
| Gene name: | GOT2 |
| Gene alias: | FLJ40994|KAT4|KATIV|mitAAT |
| Gene description: | glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2) |
| Genbank accession: | NM_002080 |
| Immunogen: | GOT2 (NP_002071, 331 a.a. ~ 430 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK |
| Protein accession: | NP_002071 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | GOT2 polyclonal antibody (A01), Lot # FHC0061120QCS1 Western Blot analysis of GOT2 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | N-terminal mutant huntingtin associates with mitochondria and impairs mitochondrial trafficking.Orr AL, Li S, Wang CE, Li H, Wang J, Rong J, Xu X, Mastroberardino PG, Greenamyre JT, Li XJ. J Neurosci. 2008 Mar 12;28(11):2783-92. |