Cart 1 Product Products 102,78 € (empty)
No products
To be determined Shipping
102,78 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 102,78 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 102,78 €
Data sheet of GNGT1 purified MaxPab mouse polyclonal antibody (B03P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about GNGT1 purified MaxPab mouse polyclonal antibody (B03P)
| Brand: | Abnova |
| Reference: | H00002792-B03P |
| Product name: | GNGT1 purified MaxPab mouse polyclonal antibody (B03P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human GNGT1 protein. |
| Gene id: | 2792 |
| Gene name: | GNGT1 |
| Gene alias: | GNG1 |
| Gene description: | guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 |
| Genbank accession: | BC029367 |
| Immunogen: | GNGT1 (AAH29367, 1 a.a. ~ 74 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS |
| Protein accession: | AAH29367 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GNGT1 expression in transfected 293T cell line (H00002792-T04) by GNGT1 MaxPab polyclonal antibody. Lane 1: GNGT1 transfected lysate(8.25 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |