GNGT1 MaxPab mouse polyclonal antibody (B03) View larger

GNGT1 MaxPab mouse polyclonal antibody (B03)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GNGT1 MaxPab mouse polyclonal antibody (B03)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about GNGT1 MaxPab mouse polyclonal antibody (B03)

Brand: Abnova
Reference: H00002792-B03
Product name: GNGT1 MaxPab mouse polyclonal antibody (B03)
Product description: Mouse polyclonal antibody raised against a full-length human GNGT1 protein.
Gene id: 2792
Gene name: GNGT1
Gene alias: GNG1
Gene description: guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1
Genbank accession: BC029367
Immunogen: GNGT1 (AAH29367, 1 a.a. ~ 74 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS
Protein accession: AAH29367
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002792-B03-13-15-1.jpg
Application image note: Western Blot analysis of GNGT1 expression in transfected 293T cell line (H00002792-T04) by GNGT1 MaxPab polyclonal antibody.

Lane 1: GNGT1 transfected lysate(8.25 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GNGT1 MaxPab mouse polyclonal antibody (B03) now

Add to cart