Cart 60 Product Products 17 440,54 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-IG...259,07 € -
1 x Dynactin 2...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
17 440,54 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 60 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 17 440,54 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 17 440,54 €
Data sheet of GNG11 monoclonal antibody (M01), clone 2H5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,PLA-Ce |
More info about GNG11 monoclonal antibody (M01), clone 2H5
| Brand: | Abnova |
| Reference: | H00002791-M01 |
| Product name: | GNG11 monoclonal antibody (M01), clone 2H5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GNG11. |
| Clone: | 2H5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2791 |
| Gene name: | GNG11 |
| Gene alias: | GNGT11 |
| Gene description: | guanine nucleotide binding protein (G protein), gamma 11 |
| Genbank accession: | NM_004126 |
| Immunogen: | GNG11 (NP_004117.1, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGS |
| Protein accession: | NP_004117.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GNG11 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |