Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00002791-B03P |
Product name: | GNG11 purified MaxPab mouse polyclonal antibody (B03P) |
Product description: | Mouse polyclonal antibody raised against a full-length human GNG11 protein. |
Gene id: | 2791 |
Gene name: | GNG11 |
Gene alias: | GNGT11 |
Gene description: | guanine nucleotide binding protein (G protein), gamma 11 |
Genbank accession: | NM_004126 |
Immunogen: | GNG11 (NP_004117.1, 1 a.a. ~ 73 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS |
Protein accession: | NP_004117.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of GNG11 expression in transfected 293T cell line (H00002791-T04) by GNG11 MaxPab polyclonal antibody. Lane 1: GNG11 transfected lysate(8.50 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |