Brand: | Abnova |
Reference: | H00002787-M04 |
Product name: | GNG5 monoclonal antibody (M04), clone 3B8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant GNG5. |
Clone: | 3B8 |
Isotype: | IgG2a Kappa |
Gene id: | 2787 |
Gene name: | GNG5 |
Gene alias: | FLJ92393 |
Gene description: | guanine nucleotide binding protein (G protein), gamma 5 |
Genbank accession: | BC003563 |
Immunogen: | GNG5 (AAH03563, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL |
Protein accession: | AAH03563 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.22 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GNG5 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |