Brand: | Abnova |
Reference: | H00002785-M01 |
Product name: | GNG3 monoclonal antibody (M01), clone 1E10-1B5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant GNG3. |
Clone: | 1E10-1B5 |
Isotype: | IgG2b kappa |
Gene id: | 2785 |
Gene name: | GNG3 |
Gene alias: | - |
Gene description: | guanine nucleotide binding protein (G protein), gamma 3 |
Genbank accession: | BC015563 |
Immunogen: | GNG3 (AAH15563, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHACEDPLITPVPTSENPFREKKFFCALL |
Protein accession: | AAH15563 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.99 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GNG3 is approximately 1ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |