Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GNAQ monoclonal antibody (M04), clone 3B9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about GNAQ monoclonal antibody (M04), clone 3B9
| Brand: | Abnova |
| Reference: | H00002776-M04 |
| Product name: | GNAQ monoclonal antibody (M04), clone 3B9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GNAQ. |
| Clone: | 3B9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2776 |
| Gene name: | GNAQ |
| Gene alias: | G-ALPHA-q|GAQ |
| Gene description: | guanine nucleotide binding protein (G protein), q polypeptide |
| Genbank accession: | NM_002072 |
| Immunogen: | GNAQ (NP_002063.2, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVI |
| Protein accession: | NP_002063.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GNAQ is 1 ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Protein kinase C ζ interacts with a novel binding region of Gαq to act as functional effector protein.Sanchez-Fernandez G, Cabezudo S, Caballero A, Garcia-Hoz C, Tall GG, Klett J, Michnick SW, Mayor F Jr, Ribas C. J Biol Chem. 2016 Feb 17. [Epub ahead of print] |