Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 204,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 204,00 €
Data sheet of GNAL polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about GNAL polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00002774-A01 |
| Product name: | GNAL polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant GNAL. |
| Gene id: | 2774 |
| Gene name: | GNAL |
| Gene alias: | - |
| Gene description: | guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type |
| Genbank accession: | NM_182978 |
| Immunogen: | GNAL (NP_892023, 359 a.a. ~ 458 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | DMLAEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLKQYELL |
| Protein accession: | NP_892023 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GNAL polyclonal antibody (A01), Lot # 050926JCO1 Western Blot analysis of GNAL expression in MCF-7 ( Cat # L046V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |