Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GML monoclonal antibody (M01), clone 5F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about GML monoclonal antibody (M01), clone 5F4
| Brand: | Abnova |
| Reference: | H00002765-M01 |
| Product name: | GML monoclonal antibody (M01), clone 5F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GML. |
| Clone: | 5F4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2765 |
| Gene name: | GML |
| Gene alias: | LY6DL |
| Gene description: | glycosylphosphatidylinositol anchored molecule like protein |
| Genbank accession: | NM_002066 |
| Immunogen: | GML (NP_002057, 48 a.a. ~ 158 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CPYHIRRCMTISIRINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLERDMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP |
| Protein accession: | NP_002057 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.95 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GML is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Expression of LY6D is induced at the surface of MCF10A cells by X-ray irradiation.Kurosawa M, Jeyasekharan AD, Surmann EM, Hashimoto N, Venkatraman V, Kurosawa G, Furukawa K, Venkitaraman AR, Kurosawa Y. FEBS J. 2012 Dec;279(24):4479-91. doi: 10.1111/febs.12034. Epub 2012 Nov 22. |