GM2A purified MaxPab mouse polyclonal antibody (B01P) View larger

GM2A purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GM2A purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about GM2A purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00002760-B01P
Product name: GM2A purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human GM2A protein.
Gene id: 2760
Gene name: GM2A
Gene alias: SAP-3
Gene description: GM2 ganglioside activator
Genbank accession: BC009273
Immunogen: GM2A (AAH09273, 1 a.a. ~ 193 a.a) full-length human protein.
Immunogen sequence/protein sequence: MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIVVPGNVTLSVVGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFERFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
Protein accession: AAH09273
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002760-B01P-13-15-1.jpg
Application image note: Western Blot analysis of GM2A expression in transfected 293T cell line (H00002760-T01) by GM2A MaxPab polyclonal antibody.

Lane 1: GM2A transfected lysate(21.34 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GM2A purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart