Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GLUL monoclonal antibody (M02), clone 3B6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about GLUL monoclonal antibody (M02), clone 3B6
| Brand: | Abnova |
| Reference: | H00002752-M02 |
| Product name: | GLUL monoclonal antibody (M02), clone 3B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GLUL. |
| Clone: | 3B6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2752 |
| Gene name: | GLUL |
| Gene alias: | GLNS|GS|PIG43|PIG59 |
| Gene description: | glutamate-ammonia ligase (glutamine synthetase) |
| Genbank accession: | NM_002065 |
| Immunogen: | GLUL (NP_002056, 274 a.a. ~ 373 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN |
| Protein accession: | NP_002056 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | GLUL monoclonal antibody (M02), clone 3B6 Western Blot analysis of GLUL expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Optimisation of the quantification of glutamine synthetase and myelin basic protein in cerebrospinal fluid by a combined acidification and neutralisation protocol.Herbert MK, Kuiperij HB, Verbeek MM. J Immunol Methods. 2012 Apr 19. |