Brand: | Abnova |
Reference: | H00002752-A01 |
Product name: | GLUL polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant GLUL. |
Gene id: | 2752 |
Gene name: | GLUL |
Gene alias: | GLNS|GS|PIG43|PIG59 |
Gene description: | glutamate-ammonia ligase (glutamine synthetase) |
Genbank accession: | NM_002065 |
Immunogen: | GLUL (NP_002056, 274 a.a. ~ 373 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN |
Protein accession: | NP_002056 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |