Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GLUD2 monoclonal antibody (M01A), clone 3C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re,WB-Tr |
More info about GLUD2 monoclonal antibody (M01A), clone 3C2
| Brand: | Abnova |
| Reference: | H00002747-M01A |
| Product name: | GLUD2 monoclonal antibody (M01A), clone 3C2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant GLUD2. |
| Clone: | 3C2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2747 |
| Gene name: | GLUD2 |
| Gene alias: | GDH2|GLUDP1 |
| Gene description: | glutamate dehydrogenase 2 |
| Genbank accession: | BC005111.1 |
| Immunogen: | GLUD2 (AAH05111.1, 1 a.a. ~ 264 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT |
| Protein accession: | AAH05111.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (54.78 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GLUD2 monoclonal antibody (M01A), clone 3C2. Western Blot analysis of GLUD2 expression in human pancreas. |
| Applications: | WB-Ti,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |