GLUD2 monoclonal antibody (M01A), clone 3C2 View larger

GLUD2 monoclonal antibody (M01A), clone 3C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GLUD2 monoclonal antibody (M01A), clone 3C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re,WB-Tr

More info about GLUD2 monoclonal antibody (M01A), clone 3C2

Brand: Abnova
Reference: H00002747-M01A
Product name: GLUD2 monoclonal antibody (M01A), clone 3C2
Product description: Mouse monoclonal antibody raised against a full length recombinant GLUD2.
Clone: 3C2
Isotype: IgG2b Kappa
Gene id: 2747
Gene name: GLUD2
Gene alias: GDH2|GLUDP1
Gene description: glutamate dehydrogenase 2
Genbank accession: BC005111.1
Immunogen: GLUD2 (AAH05111.1, 1 a.a. ~ 264 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT
Protein accession: AAH05111.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002747-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (54.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002747-M01A-2-A7-1.jpg
Application image note: GLUD2 monoclonal antibody (M01A), clone 3C2. Western Blot analysis of GLUD2 expression in human pancreas.
Applications: WB-Ti,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GLUD2 monoclonal antibody (M01A), clone 3C2 now

Add to cart