GLS monoclonal antibody (M02), clone 6H1 View larger

GLS monoclonal antibody (M02), clone 6H1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GLS monoclonal antibody (M02), clone 6H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GLS monoclonal antibody (M02), clone 6H1

Brand: Abnova
Reference: H00002744-M02
Product name: GLS monoclonal antibody (M02), clone 6H1
Product description: Mouse monoclonal antibody raised against a partial recombinant GLS.
Clone: 6H1
Isotype: IgG2a Kappa
Gene id: 2744
Gene name: GLS
Gene alias: AAD20|DKFZp686O15119|FLJ10358|GLS1|KIAA0838
Gene description: glutaminase
Genbank accession: NM_014905
Immunogen: GLS (NP_055720, 580 a.a. ~ 669 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
Protein accession: NP_055720
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002744-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002744-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged GLS is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GLS monoclonal antibody (M02), clone 6H1 now

Add to cart