Cart 27 Product Products 9 371,01 € (empty)
No products
265,00 € DAP Shipping
9 636,01 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 27 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 9 371,01 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 9 636,01 €
Data sheet of GLS monoclonal antibody (M01), clone 5C4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about GLS monoclonal antibody (M01), clone 5C4
| Brand: | Abnova |
| Reference: | H00002744-M01 |
| Product name: | GLS monoclonal antibody (M01), clone 5C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GLS. |
| Clone: | 5C4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2744 |
| Gene name: | GLS |
| Gene alias: | AAD20|DKFZp686O15119|FLJ10358|GLS1|KIAA0838 |
| Gene description: | glutaminase |
| Genbank accession: | NM_014905 |
| Immunogen: | GLS (NP_055720, 580 a.a. ~ 669 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL |
| Protein accession: | NP_055720 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to GLS on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Combination of neonatal PolyI:C and adolescent phencyclidine treatments is required to induce behavioral abnormalities with overexpression of GLAST in adult mice.Hida H, Mouri A, Ando Y, Mori K, Mamiya T, Iwamoto K, Ozaki N, Yamada K, Nabeshima T, Noda Y Behav Brain Res. 2013 Sep 20. pii: S0166-4328(13)00576-7. doi: 10.1016/j.bbr.2013.09.026. |