Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GLS polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about GLS polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00002744-A01 |
| Product name: | GLS polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant GLS. |
| Gene id: | 2744 |
| Gene name: | GLS |
| Gene alias: | AAD20|DKFZp686O15119|FLJ10358|GLS1|KIAA0838 |
| Gene description: | glutaminase |
| Genbank accession: | NM_014905 |
| Immunogen: | GLS (NP_055720, 580 a.a. ~ 669 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL |
| Protein accession: | NP_055720 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | MYC regulates the unfolded protein response and glucose and glutamine uptake in endocrine resistant breast cancer.Shajahan-Haq AN, Cook KL, Schwartz-Roberts JL, Eltayeb AE, Demas DM, Warri AM, Facey CO, Hilakivi-Clarke LA, Clarke R Mol Cancer. 2014 Oct 23;13:239. doi: 10.1186/1476-4598-13-239. |