GLRA1 monoclonal antibody (M07), clone 3G8 View larger

GLRA1 monoclonal antibody (M07), clone 3G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GLRA1 monoclonal antibody (M07), clone 3G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GLRA1 monoclonal antibody (M07), clone 3G8

Brand: Abnova
Reference: H00002741-M07
Product name: GLRA1 monoclonal antibody (M07), clone 3G8
Product description: Mouse monoclonal antibody raised against a partial recombinant GLRA1.
Clone: 3G8
Isotype: IgG2a Kappa
Gene id: 2741
Gene name: GLRA1
Gene alias: MGC138878|MGC138879|STHE
Gene description: glycine receptor, alpha 1
Genbank accession: NM_000171
Immunogen: GLRA1 (NP_000162, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE
Protein accession: NP_000162
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002741-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002741-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GLRA1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GLRA1 monoclonal antibody (M07), clone 3G8 now

Add to cart