No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00002741-M04 |
| Product name: | GLRA1 monoclonal antibody (M04), clone 2G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GLRA1. |
| Clone: | 2G4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2741 |
| Gene name: | GLRA1 |
| Gene alias: | MGC138878|MGC138879|STHE |
| Gene description: | glycine receptor, alpha 1 |
| Genbank accession: | NM_000171 |
| Immunogen: | GLRA1 (NP_000162, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE |
| Protein accession: | NP_000162 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged GLRA1 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |